Please note that this is only a preview and some information is blurred. Please Register or Login to view the data.
Social Profiles
Profile Not Found
Profile Not Found
Profile Not Found
Profile Not Found
Reviews In case of a business with multiple locations, we will return a random location.
Not Found
Yelp
Not Found
Not Found
You can find Vinh Long Vietnamese in these locations.
Vinh Long Vietnamese
Name Vinh Long Vietnamese
Website http://vinhle160fe718d154f2d28f43e151c2f5e3bte
Mobile Friendly
Facebook Pixel
Google Analytics
SEO Schema
Wordpress / Shopify /
Domain Registrar Hostinger Operations, Uab
Domain Host vinhlongvietnamesewinnipeg.cafecityguide.website
Online Since 1st Jan 1970
Advertising Data
Here is the information we have found scanning the web.
| Service | Answer |
|---|---|
| Yelp Ads | Not Detected |
| Facebook Ads | Not Detected |
| Messenger.com Ads | Not Detected |
| Instagram Ads | Not Detected |
| Facebook Pixel | No |
| Google Pixel | Yes |
| Google Analytics | Yes |
| Linkedin Analytics | No |